PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10033119
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 367aa    MW: 40772.4 Da    PI: 5.0349
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10033119genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.85.2e-181562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT++Ed +++  v+++G+g+W++++++ g++R++k+c++rw++yl
      Lus10033119 15 RGLWTPDEDAKILAHVAKYGTGNWTSVPKKAGLRRCGKSCRLRWNNYL 62
                     788********************************************7 PP

2Myb_DNA-binding44.34.2e-1470111346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       + +eE+e +v+++   G++ W+ Ia+ ++ gRt++++k++w++
      Lus10033119  70 TFKPEEEEMIVRLHSAIGSR-WSIIAQQLP-GRTDNDVKNHWNT 111
                      5889****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-24765IPR009057Homeodomain-like
PROSITE profilePS5129427.2991066IPR017930Myb domain
SuperFamilySSF466899.56E-3012109IPR009057Homeodomain-like
SMARTSM007176.0E-151464IPR001005SANT/Myb domain
PfamPF002498.6E-171562IPR001005SANT/Myb domain
CDDcd001673.00E-121862No hitNo description
Gene3DG3DSA:1.10.10.609.9E-2366117IPR009057Homeodomain-like
PROSITE profilePS5129418.03367117IPR017930Myb domain
SMARTSM007171.9E-1267115IPR001005SANT/Myb domain
CDDcd001673.71E-970113No hitNo description
PfamPF002492.7E-1270111IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MVRPPSCCGN VNLKRGLWTP DEDAKILAHV AKYGTGNWTS VPKKAGLRRC GKSCRLRWNN  60
YLRPDLNHET FKPEEEEMIV RLHSAIGSRW SIIAQQLPGR TDNDVKNHWN TKLRKKLSEM  120
GIDPVTHKPF SQILTDYGNI NGGLSRSPST TRIGSLSRDL KNATSNTTIV FVHNPLPQSS  180
VNFMESESES EITISESFII DTDHVKEEQS MDLLEQLQAI KLVIEAGNCK DENVTPAAGN  240
PSCSSSSSST CSTTAAQEMT MMTMKSSPQA FSWRDFLLED DDDLDQLLPD GNDDDDDDVI  300
ISRDQLWSSG EKQRLPRHKQ NCYGAAASNV NGGPTTSSSF VDAILDGDRR HDMFLDFSSL  360
LQDPNY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-2891171108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012448458.11e-111PREDICTED: transcription factor MYB86
RefseqXP_012448457.11e-111PREDICTED: transcription factor MYB86
RefseqXP_012448456.11e-111PREDICTED: transcription factor MYB86
TrEMBLA0A0D2UC281e-111A0A0D2UC28_G
STRINGPOPTR_0015s07900.11e-110(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.15e-68MYB family protein